PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_24525_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 277aa    MW: 32097.2 Da    PI: 9.8416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_24525_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-15754148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g W +eEd++l ++v+ +G g W+t++++ g++R + +c++rw +yl
  cra_locus_24525_iso_2_len_829_ver_3  7 KGFWKPEEDLILRKYVEIHGEGKWRTVSEKSGLKRGGRSCRLRWKNYL 54
                                         688*****************************99************97 PP

2Myb_DNA-binding51.32.7e-1660105148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_24525_iso_2_len_829_ver_3  60 RGEMSEQEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 105
                                          8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-21257IPR009057Homeodomain-like
PROSITE profilePS5129425.46258IPR017930Myb domain
SuperFamilySSF466895.62E-284101IPR009057Homeodomain-like
SMARTSM007171.1E-12656IPR001005SANT/Myb domain
PfamPF002492.6E-12854IPR001005SANT/Myb domain
CDDcd001674.03E-91054No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2258107IPR009057Homeodomain-like
PROSITE profilePS5129419.61459109IPR017930Myb domain
SMARTSM007172.9E-1659107IPR001005SANT/Myb domain
PfamPF002498.6E-1560105IPR001005SANT/Myb domain
CDDcd001675.19E-1162105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
XKPKLKKGFW KPEEDLILRK YVEIHGEGKW RTVSEKSGLK RGGRSCRLRW KNYLRPNIKR  60
GEMSEQEKDL IIRLHKLLGN RWSLIAGRLP GRTDNEVKNY WNTHLHKVVS GDKTKEQQQQ  120
QMVKSPKPQV PSSATMAKTS PPDDKETEKM NHQVRSLSLQ DFAQIFWDEG TFSLTTENIL  180
FHPFVGDDDF QSFLLLXNQS YSACPAATKC SDWESSFSAQ FRDARNCSRL LLAYLFCSKC  240
LLAVGQSRTS SIYTTLPITV IKFHYESNIQ PCRETFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-23310923128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282342.11e-65PREDICTED: transcription factor MYB82
TrEMBLD7TC471e-65D7TC47_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g05660.t014e-65(Vitis vinifera)